SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc01_g018130 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc01_g018130
Domain Number 1 Region: 345-456
Classification Level Classification E-value
Superfamily POZ domain 7.06e-20
Family BTB/POZ domain 0.0084
Further Details:      
 
Domain Number 2 Region: 175-273
Classification Level Classification E-value
Superfamily POZ domain 3.69e-18
Family BTB/POZ domain 0.005
Further Details:      
 
Domain Number 3 Region: 42-119
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000912
Family Ankyrin repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc01_g018130
Sequence length 590
Comment Putative Ankyrin repeat and BTB/POZ domain-containing protein 1
Sequence
MPPSPPHSSSWTISADLDDIDLDASDFTASVPLKKVPNGDIFEASRAGDVDRLRYLLESG
VNVNARDNWDSVALYYACLAGHLDAARMLLENGAICSEHTFDGDRCHYAALNLKVRKLLK
AFEARPPPLGPLQGALRDTFLSCGANQAYLDQAAESGLHFEVSGLASNGASSSYQFPPDV
VFFVQGRPIEAHRVILSARSPFFKRKFETDWKDRSEVRFSREKLSYPALYSLIHFFYSDR
LEVAVDDMEDLVRICKVCKCDSLQRVLEKELIHQKYAEYKALRDVDNSQKRFILQGLSLP
EEDRLPAALHRVLQISLAKSPKECNLDNGVDTLQYYVGAMQISDSLDDLADVCVRVDKRI
FRCHQVVLASRSEYFNARLSRMKDFHEWKDELTSDTLPFLEEHDLSAEAFEKMIEYMYTD
GLTDIDPDQAEEMFDAASRYLLFPLKRAVADVLLPHLEMVSPAELCHWLILSDMYGVLKI
RESCLDTIACNFETFADICEFRAMLLTLPPPSGDSSLRTTVPSAPGAAINTDQANLLDDL
REKWLEAEGAELDKRDESALLFDKRLEMLMLVAEQEKSVPSAEDGEDCII
Download sequence
Identical sequences XP_007049232.2.67643 Tc01_g018130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]