SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc01_g022390 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc01_g022390
Domain Number 1 Region: 22-123
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000173
Family BTB/POZ domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc01_g022390
Sequence length 620
Comment BTB/POZ domain-containing protein At5g48800
Sequence
MDKQQQQQQHHHHHQQQLSLAKSSRQRYNEWIFRDVPSDITIEVNGGTFALHKFPLVSRS
GRIRKLVAEHRDSDISRVELLNLPGGAESFELAAKFCYGINFEITSLNVAQLCCVSDYLE
MTEEFSKDNLGSRAEEYLESIICKNLEMCVEVLQQCENLLPLADELKIVSRCIDAIASKA
CAEQIASSFSRLEYSSSGRLHMNRQAKCEGDWWIEDLSVIRIDLYQRVMTAMKCRGVRPE
SIGASLVNYAQKELTKKSSLWNPSGQTKVDLVSTGHERLVVETVVSLLPVEKLAVPISFL
FGLLRSAVMLDCTIACRLDLERRIGSQLDIATLDDLLIPSFRHAGDTLFDVDTVQRILVN
FSQQDDSEDDMDDASVFESDSLHSPSQSALFKVAKLVDNYLAEIAPDANLKLAKFMAIAE
TLPAHARTIHDGLYRAIDIYLKAHQGLPDADRKKLCKLIDFQKLSQEAGAHAAQNERLPL
QSIVQVLYFEQLRLRNALCCSYADDDHKPVHHQSWRISSGALSAAMSPRDNYASLRRENR
ELKLELARLRMRLNDLEKEHVCMKRDMAKSHSRKFMSSFSKKIGKLSFFGHSSSRGSSSP
SRQSYRTDSKVIERTCASTD
Download sequence
Identical sequences Tc01_g022390 XP_007049780.2.67643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]