SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc01_g028370 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc01_g028370
Domain Number 1 Region: 694-879
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000408
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 
Domain Number 2 Region: 383-411,474-493,527-546,605-740
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000835
Family Tetratricopeptide repeat (TPR) 0.046
Further Details:      
 
Domain Number 3 Region: 174-278
Classification Level Classification E-value
Superfamily POZ domain 0.00000000275
Family BTB/POZ domain 0.029
Further Details:      
 
Weak hits

Sequence:  Tc01_g028370
Domain Number - Region: 287-330,377-426
Classification Level Classification E-value
Superfamily HCP-like 0.00418
Family HCP-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc01_g028370
Sequence length 888
Comment ETO1-like protein 1
Sequence
MRTFFPSDSCKESQLNAINPQSWLQVERGKLSKFSSSHTTSSSIESFIKVPEPPVVPFFK
PIDYVEVLAQIHEELESCSPQERSNLYLLQFQIFRGLGETKLMRRSLRSAWQKAGTVHER
LVFGAWLKYEKQGEELIADLLATCNRCAQEFGPIDVVSQHPSKVNGSSQETAVMNGDQSL
KNVNFRIGDEKIVCDRQKIASLSAPFHAMLNGYFTESLCEDIDLSENNISPLGMRTIGEF
SMTGTLSEVPPDLLLEILVFANKFCCERLKDDCDRKLASLVCTKDDAVELMEYAIEENSP
VLAASCLQVFLHELPDCLNDEQVAEIFSHADRQQRSIIVGQASFSLYCLLSEVAMNLDPR
SDKTVCFLEQLIESAETDRQRLLAFHQLGCVRLLRKEYDEAERLFEAAVSLGHVYSIAGL
ARLSYIKGHKLWSYEKLSSVISSVNPLGWMYQERSLYCEGDKRWEDLEKATELDPTLTYP
YMYRAASLMMKQNVQVALAEINRVLGFKLALECLELRFCLYLAIEDYKAAIRDVQAILTL
SPDYRMFEGRVAASQLRTLVREHVDNWTTADCWMQLYDRWSSVDDIGSLSVIYQMLESGG
AKGVLYFRQSLLLLRLNCPDAAMRSLELARQHASSEHERLVYEGWILYDTGHCEEGLRKA
EESIKIKRSFEAFFLKAYALADSSLDLSCSSTVISLLENALKCPSDNLRKGQALNNLGSV
YVDCGKLDSAADCYINALKIRHTRAHQGLARVHFLRNDKAAAYEEMTKLIEKAKNNASAY
EKRSEYCDRDLTKADLEMVTRLDPLRVYPYRYRAAVLMDSYKEKEAIAELSKAIAFKADL
HLLHLRAAFHEHVGDVLGALRDCRAALSVDPNHQEMLELHSRVNSHEP
Download sequence
Identical sequences Tc01_g028370 XP_017979355.1.67643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]