SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc01_g028870 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc01_g028870
Domain Number 1 Region: 30-169
Classification Level Classification E-value
Superfamily TRAF domain-like 1.39e-35
Family MATH domain 0.0005
Further Details:      
 
Domain Number 2 Region: 180-310
Classification Level Classification E-value
Superfamily POZ domain 1.92e-30
Family BTB/POZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc01_g028870
Sequence length 406
Comment Putative Speckle-type POZ protein-like
Sequence
MGRVLRETSKPSSSSASSVSATTTSTSVTETVNGSHQFKITGYSLSKGLGIGKYIASDTF
MVGGYLWAIYFYPDGKSPEDNAAYVSLFIALASEGTDVRALFELTLLDQSGKERHKVHSH
FGRTLESGPYTLKYRGSMWGYKRFFKRTLLEQSDYLKDNCLSVHCSVGVVKSHTEGPKVY
SIAVPPSNIGHHFGQLLESGKGTDVSFEVDGEVFPAHKLVLAARSPVFRAQLFGPMKDQN
TRKIKVEDMEAPVFKALLHFIYWDCLPDMQELTGLNSKWASTLMSQHLLAAADRYGLDRL
RLLCEANLCEDVAINTVATTLALAEQHHCFQLKAVCLKFVAMPENLRAVMQTDGFEYLKE
SCPSVLTELLEYVARVNEHSVIVCRHGNEAILDGSDANGRRVKQRL
Download sequence
Identical sequences Tc01_g028870 XP_017983235.1.67643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]