SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc01_g029790 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc01_g029790
Domain Number 1 Region: 22-118
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000942
Family BTB/POZ domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc01_g029790
Sequence length 626
Comment Putative BTB/POZ domain-containing protein At5g48800
Sequence
MGSSMGMQVHGRRNNMISKLLALTNLPISDVSSDLTIEVGASSFALHKFPLVSRSGRIRK
LLIDAKDAKISRVNISSVPGGPEAFELAAKFCYGINVEITLSNVAMLRCASHFLEMTEEF
AEKNLEARTEAYLKDMVLPNISSSISVLHRCESLLPISEEINLVNRLINAIANNACKEQL
TSGLLKLDHNYPSKAMPNMEPETPSDWWGKSLAVLNLDFFQRVLSAVKSKGLKQDMISKI
LINYTHNSLQGLVVRDPHLVKGSLLDLELQKKQRVIVEAMVSLLPTQSRKSSVPMAFLSS
LLKAAIASSASTSCRSDLERRIGLQLDQAILEDILIPANSHGNNHTTMYDTESILRIFSI
FLNLDEDDDEDNPLRDESEMAYDFDSPGSPKQSSILKVSKLLDTYLAEVALDPNLLPSKF
IALAELLPDHARIVSDGLYRAVDIFLKVHPNIKDSERYRLCKTIDCQKLSQEACSHAAQN
ERLPVQMAVQVLYFEQIRLRNAMSGGHNQFFFGAINGQFPQRSSSGAGSGAISPRDNYAS
VRRENRELKLEVARMRMRLTDLEKDHVSMKQELVRTHPANKLFKSFTKKLSKLNSLFRIN
NLKPIGGKANSESRFLFQRRRRHSVS
Download sequence
Identical sequences A0A061DQG7
Tc01_g029790 XP_007050813.1.67643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]