SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc01_g034990 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc01_g034990
Domain Number 1 Region: 295-406
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000137
Family MATH domain 0.016
Further Details:      
 
Weak hits

Sequence:  Tc01_g034990
Domain Number - Region: 44-94
Classification Level Classification E-value
Superfamily POZ domain 0.00022
Family BTB/POZ domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc01_g034990
Sequence length 408
Comment Predicted protein
Sequence
MQIFLLFSNGMRESEQRHVTLRINASGMCEQAKLNNNSNITLYTEEAALMELLNFIYSNT
LSVTTAPALLDVLMAADKFEVASCMRYCSQLLRNLPMTPESALLYLDLPSSVLMGEAVQP
LTDAAKQYLAARYKDMTKFQEEVMALPLAGIEAILSSDDLQIASEDAVYDFVLKWARAQY
PKLEERREVLGSRLARFIRFPYMTCRKLKKVLTCNDFDHDAASKLVLEALFFKAEAPHRQ
RSLAVEESATMNRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKKEECANLFPSGRVYSQ
AFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSLSFAVDYEFAARSKPTEEFVSKY
KGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGILHLRAELTIRQ
Download sequence
Identical sequences Tc01_g034990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]