SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc02_g004900 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc02_g004900
Domain Number 1 Region: 79-154
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.88e-32
Family Skp1 dimerisation domain-like 0.0000236
Further Details:      
 
Domain Number 2 Region: 7-67
Classification Level Classification E-value
Superfamily POZ domain 2.25e-21
Family BTB/POZ domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tc02_g004900
Sequence length 156
Comment SKP1-like protein 1A
Sequence
MASTSKKIMLRSSDGEAFEVEEAVAVESQTIKHMIEDDCADNEIPVPNVTSKILAKVLEY
CKKHVDAAADKEKIPEDDLKVWDADFVKVDQNTLFDLILAANYLNIKSLLDLTCQTVAEM
IKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE
Download sequence
Identical sequences A0A061DY20
CGD0008286 XP_007041813.1.67643 Tc02_g004900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]