SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc02_g008120 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc02_g008120
Domain Number 1 Region: 3-92
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000183
Family B3 DNA binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc02_g008120
Sequence length 126
Comment Putative B3 domain-containing transcription factor NGA4
Sequence
MKLFSKLLTQTDIEKRLSVPTHILHLFPFLDGDRFADLQVKDSSGGLWTFRCIYRDGIYA
KPVFSKGWLEFVYAKNLQIDDEVAFHKDKDIEAAVPYRIEVKRKIMRLMGQDIWIEVEQL
HLYGLS
Download sequence
Identical sequences Tc02_g008120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]