SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc02_g010110 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc02_g010110
Domain Number 1 Region: 43-139
Classification Level Classification E-value
Superfamily POZ domain 9.42e-18
Family BTB/POZ domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tc02_g010110
Sequence length 646
Comment Putative BTB/POZ domain-containing protein At1g30440
Sequence
MFHWLRRSFRGFRREEDLLLANMKFMKLGSKPDTFQSDGNNVRYVASELATDITVIVGDV
KFYLHKFPLLSKSACLQKLVASSNEEKSDEVQISDIPGGPVAFEMCAKFCYGMTVTLNAY
NVVAARCAAEYLGMHETIEKGNLIYKVDVFLNSSIFRSWKDSIIVLQTTKSMLPLSEELK
VVSLCIDAVAIKACVDVSNVDWSYTYNRRKLPEENGNDPNYNGVRSRPVPKDWWVEDLCE
LEIDLYKRAIMNIKTKGILSHEVIGEALKAYSYRRLPGFSKGVIHSGDVVKYRSTVDTIV
WLLPAEKGSVSCSFLLKLLKAAIIVDSGETAREQLVRSIGQQLEEASVNDLLIRAPEGED
ALYDVDTVQKIVKEFLMQDQNAEIESDENEVQEIQRPGILTDASKLMVAKLIDAYLAEIA
KDPNLPLSKFVNLAEMVSCISRPAHDGLYRAIDMYLKEHPGISKSERKRICKLMDCKKLS
VDACMHAVQNERLPLRVVVQVLFFEQVRAAASSGSSTPDLPKGLKDLNSGSHGSSRSAAT
NPEEDWDAVATAEELKALKGELAALRLSNGVGGSERNGVDSRNSVDKAAISKMKGLLKSK
RIFTKIWSSKGAQGENSGSDSSESLGSANPEEAKSTPSRNRRHSVS
Download sequence
Identical sequences Tc02_g010110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]