SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc02_g010860 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc02_g010860
Domain Number 1 Region: 34-131
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000275
Family BTB/POZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc02_g010860
Sequence length 673
Comment Root phototropism protein 3
Sequence
MWESENESVRGRDYANGVLSSSKHGVKTDGFELRGQSWYVATDIPSDLQVQVGDVNFHLH
KYPLLSRSGKINRLIYESHDPDLNKIALEDLPGGPEAFELAAKFCYGIAVDLTAGNISGL
RCAAEYLEMTEDLEEGNLIFKTEAFLSYVVLSSWRDSILVLKSCEKLSPWAENLQIVRRC
SESIAWKACANPKGIKWAYTGRPTKVSSPKWNDLKDSSPSRNQPVPPDWWFEDVSILRID
HFVRVITAIKVKGMRFELIGASIMHYAAKWLPGLIKDGQGQGDDTSISSNSNSSGSSSWK
GGLHMIVAGTKDDTPSIQSKDQRMIIESLISIIPPQKDSVSCSFLLRLLRMANMLKVAPA
LVTELEKRVGMQFEQATLADLLIPSYNKSETLYDVDLVQRLLEHFLVQEQTESSSPSRQS
FTDKHMYEGAQRGNNPNAKMRVARLVDSYLTEVSRDRNLSLTKFQVLAEALPESARTCDD
GLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSIDACMHAAQNERLPLRVVVQVLFSEQ
VKISNALANTTLKDPAETQYQPLIPNRKTLLEGTPQSFQEGWVAAKKDINTLKFELESVK
TKYLVLQNDMENLQRQFDKMSKQKQTSAWTSGWKKLSKLTKMTTVENQDIGPQISTTAEQ
TRKAPRRWRNSIS
Download sequence
Identical sequences Tc02_g010860 XP_017971889.1.67643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]