SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc02_g024910 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc02_g024910
Domain Number 1 Region: 21-115
Classification Level Classification E-value
Superfamily POZ domain 2.75e-16
Family BTB/POZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc02_g024910
Sequence length 632
Comment Putative Root phototropism protein 3
Sequence
MKFMKLGSRPDTFYTAEAVRSVSSEVSSDLIIQVKGSRYLLHKFPLLSKCLRLQRLCSES
PETSQHQIIQLPDFPGGIEAFELCAKFCYGITITLSAYNIVSARCAAEYLQMTEDVEKGN
LVYKLEVFFNSCILHGWKDSIVTLQSTKAFPLWSEDLGITSRCIEAIASKVLTHPSKVSL
SHSHSRRVRDDISCNGAESQRHKPTTKGWWAEDMAELGIDLYWRTMIAIKSGGKIPSNLI
GEALQIYASRSLPNISRQIKANKEAASDSDSDSAGEVTSKHRLLLESIVSLLPSEKGAVS
CSFLLKLLKAANILNASSSSKMELARRVALQLEEARVSDLLIPSLSHSSDTLYDVDVDIV
MIILEQFMLQGQSPPTSPQRSKLGFERRRRSRSAENIDFEFHESRRSSSASHSSKLKVAK
IVDGYLQEIARDKKLPLSKFIAIAETIPDFSRHDHDDLYRAIDIYLKAHPDLNKSERKKL
CRVLDCKKLSVEACMHAAQNEKLPLRVVVQVLFFEQARAATAGGKVTELPSNIKALLASH
NIDPSRPPGPLSTTTSIQADDQWSVSGLKSPKSRISTLRMKLAEDDDLDEKDTHTDGMGR
PSKFKAFCALPARPKKMFSKLLSINRSGSEKN
Download sequence
Identical sequences XP_007044812.2.67643 Tc02_g024910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]