SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc03_g007470 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc03_g007470
Domain Number 1 Region: 54-156
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 1.44e-25
Family Steroid-binding domain 0.0000923
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc03_g007470
Sequence length 184
Comment Membrane steroid-binding protein 2
Sequence
MGIYSTVMDAVTEVTGLSPTAFFTIIAMMVVVYKIVCGMFLGPEDFCQKPPKEPVQLGDV
TEKELRAYDGSDPRKPLLIAIKGQIYDVSSSKMFYGRGGPYSMFTGRDASRALAMLSFKP
EDLTGNIEGLSAEELAVLEDWEYKFMDKYPIVGRVVPVPNTTANGDKVHLQDKDVNGLQH
QQQI
Download sequence
Identical sequences XP_007036710.2.67643 Tc03_g007470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]