SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc03_g013990 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc03_g013990
Domain Number 1 Region: 199-303
Classification Level Classification E-value
Superfamily TAZ domain 6.54e-20
Family TAZ domain 0.00065
Further Details:      
 
Domain Number 2 Region: 24-89,124-150
Classification Level Classification E-value
Superfamily POZ domain 0.00000000126
Family BTB/POZ domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc03_g013990
Sequence length 354
Comment Protein binding protein, putative
Sequence
MEDKNNHNTTSSVISSAPELPEPDVQILTSGGLRIAAHSSILAMVSPVLENIMDRPRKHR
TSERVIPILGVPCDAVSAFVGYLYSTRCTEEQMEKYGIHLLALSHVYSVTQLKQRCARGV
SQRLTIENVVDELQLARLCDAPDLYLKCMKLVAAHFKSVEQTEGWKFMQDHDPWLELEIL
QFIDEAESRKKRTRRHRVEQSLYLQLSEAMECLEHICTEGCTTVGPYDVEPAKKRGPCNK
YTTCQGVQLLIKHFASCKRRANGGGCSRCKRMWQLLRLHSSICDQPDSCRVPLCRQFKLK
AQQQIMGDDALWKLLVRKVLSAKTISSLSLPKRKREEELRETMGGHALRTFRLC
Download sequence
Identical sequences XP_017973901.1.67643 Tc03_g013990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]