SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc03_g020260 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc03_g020260
Domain Number 1 Region: 90-157
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 3.66e-16
Family Skp1 dimerisation domain-like 0.00052
Further Details:      
 
Domain Number 2 Region: 15-79
Classification Level Classification E-value
Superfamily POZ domain 0.00000000204
Family BTB/POZ domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc03_g020260
Sequence length 398
Comment SKP1-like protein 21
Sequence
MSEGVMAVVKPEMKSYIWLQTTDGSIQQVEEEVAMFCPMICREILQTGMGSSKNYAISLP
QRVNPAILGLILDYCRFHQVPGHSNKERKTFNEKFVRMDTKRLCELTSAADSLQLKPLVD
LTSRALARIIEGKTPEEIRETFHLPDDLTEEEKLEPLRNITDDPRIRLLNRLYARKRKEL
KEREKLKNVEVEEERVDERSVDDLLSFINGGDQDSKGVRTTKNKKKNRRRKEQLKHSSDS
VDVNYNKELDAAPAACNQGNIDNILVPTRSKTSKLQDSSAVIFSPKMEFDDADIDDDIDP
AMKEELDRWSTHLFLQEYILIFLWMKSEVYSSSVEVEDFARRLNSDWPERMQEILSLGHE
RRLVPMSINGEGPMSRFSSKMDGCLSGLKMILATNLLL
Download sequence
Identical sequences Tc03_g020260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]