SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc03_g023250 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Tc03_g023250
Domain Number - Region: 40-106
Classification Level Classification E-value
Superfamily POZ domain 0.0157
Family Tetramerization domain of potassium channels 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tc03_g023250
Sequence length 124
Comment Putative uncharacterized protein
Sequence
MDCLVLPVSLLRRRCTTSGLRYRPLRQDGYGDLDRQVTVVVGKEKREFLVDPFVLEESPF
RALIDTMKKEYGSQVDARREKRRVIFVDVDAILFEHMLWLMNNDCSSLFQLNLEEIIDFY
AQDN
Download sequence
Identical sequences A0A061G368
CGD0016432 XP_017972364.1.67643 Tc03_g023250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]