SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc03_g027620 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc03_g027620
Domain Number 1 Region: 17-102
Classification Level Classification E-value
Superfamily POZ domain 2.75e-16
Family Tetramerization domain of potassium channels 0.006
Further Details:      
 
Domain Number 2 Region: 127-444
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000212
Family Quinoprotein alcohol dehydrogenase-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc03_g027620
Sequence length 469
Comment Potassium channel tetramerization domain-containing protein, putative
Sequence
MSSFGMQCLETEPELNSNVVTINVGGQIFQTTKQTLTQGGPKSLLSQLAETTSKRFVDRD
PDYFSLLLSLLRSGTLPSKVKDFDLHDLIEESRFYGLESLLNNSLTNPSHFDAFALQKSL
ILPLNGRDSPSTIATTPSGTVHVAHGSKITSFDWSLTRKSTILTQFTAVDSLLAISPDIA
AAGATDFSGLQILDLQNGSVKQVLNWENVTRSGSTVQAIGSSSEFLFTSFESGRRNSNSI
MVYDLNTLNPVTEIGHNEIFGADLDSAIPATKLRWVTGYGLVMASGSHSGLSGVSGNIKF
WDIRSGNVVFELKEKDDCFSDVCVSDNLNAIFKVGVNSGEVFYTDLRSLGSVSDDANDNS
NPWICLGNSRKVVNGKKEGYGCKIESHGNQVFCSKGGDIELWSEVVMGSAKISEGPLKER
RVFRKNLMGRVKDLGGLRITNLAFGGNRMFVIRKDQQAVEIWQGSTRGI
Download sequence
Identical sequences A0A061G5W2
XP_007040282.1.67643 CGD0015991 Tc03_g027620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]