SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc03_g027810 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Tc03_g027810
Domain Number - Region: 243-362
Classification Level Classification E-value
Superfamily POZ domain 0.000408
Family BTB/POZ domain 0.027
Further Details:      
 
Domain Number - Region: 97-108
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0068
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tc03_g027810
Sequence length 657
Comment Predicted protein
Sequence
MATATTTTTTKSISTKTSSAQLKVQVQPIKPKRRKCKETTISSSASTAAPTTATTAATNS
YSESGFSGVLTRKLDPPTIVSPDNTWCCPASKPLPTPPPPPPSPPLPPQARRGPDPCFAD
SISGFRIRYSPGSLSPVMDFTGGTTLSNGHSPSSFTKFNSALTAGLLNPMSPPPPPDKTR
SSPTLFEMMASEPDIHPRNQSQNQAQIQVPISAPRQNQPPPVIDKQALTMQRISDLLSNR
SPGNQFNDPGSSDIKLTLSSKDGISVSMNVHRQILVAHSRFFAVKLSDRWAKQQRNGSGG
PYIVEIADCDDVEVYIETLRLMYCKDLRKKLMREDVSKVLGILKVSAAIGFDAGVLSCLE
YLEAAPWAEDEEEKVASLLAELRLENVGAGEVLKRVSVEVTNGTDEGGDNEEVLLKLLHV
VLEGKDEKARREMKGLVSKMLRENSSQNDLRKESLYSACDGCLELLRHHFLRAASSDLQD
VSQIARQADNLHWILDILIDRQIAEDFLKSWASQSELSDAHSKVPAVHRYEVSRVTARLF
VGIGKGQLLASKEMRCLLLQTWLVPFYDDFGWMRRASKGLDRHLIEDGLSNTILTLPLAW
QQEILLAWFDRFLNSGEDCPNIQRGFEVWWRRAFWRRSGEQEPPRQLQVTTATIENS
Download sequence
Identical sequences XP_007040315.2.67643 XP_007040316.2.67643 XP_007040319.2.67643 XP_017973381.1.67643 Tc03_g027810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]