SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc03_g028060 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc03_g028060
Domain Number 1 Region: 110-145
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.000000327
Family Skp1 dimerisation domain-like 0.0019
Further Details:      
 
Weak hits

Sequence:  Tc03_g028060
Domain Number - Region: 56-98
Classification Level Classification E-value
Superfamily POZ domain 0.0259
Family BTB/POZ domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc03_g028060
Sequence length 151
Comment Putative SKP1-like protein 11
Sequence
MSNVACVGRKPFEVVIGYTAGNLNVINKIELDPNYRNWFFKESGPEPLFKPNSHRVLKLK
SSDIRIFDLEEDIAVLSELINGDPGVLPARNVDSKTLARGSRNGARKVFTTPNLLLAANY
FEVKVLLDETCESVADMIKQMRPDEHQFHSC
Download sequence
Identical sequences Tc03_g028060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]