SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc04_g017120 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc04_g017120
Domain Number 1 Region: 283-384
Classification Level Classification E-value
Superfamily TAZ domain 4.71e-24
Family TAZ domain 0.00043
Further Details:      
 
Domain Number 2 Region: 88-171,207-236
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000012
Family BTB/POZ domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc04_g017120
Sequence length 418
Comment Protein binding protein, putative
Sequence
MIQDIWEEVYLMASLAIDSAWLPSPSESLCRSLNVCVEEANPADILPALEAPMSSVSDNC
NIPKPPPLPSKVRTRTKYSKRPLECSLVPKETKNTWDKLFKEGYGVDVCIITKDKSCVLA
HSNILSIASPVLSNILSRSKVKHGMRYIKIPGVPHDAIFMFIRFLYSSCYEEEELRKFVL
HLLVLSHSYSVLPLKRVCICLLEQGWLTRENVIDVLQLAKNCDAPRLAFICVRMIVKDFK
SISSTEGWKVMKRANPALEQELVESVVEADSRKQERQRKMEEKKVYLQLYEAMEALLHIC
KDGCRTIGPRDKVLKGSQVTCNFPACKGLETLVRHFSNCKTRVPGGCVHCKRMWQLLELH
SRMCNEPDSCKVPLCRHFKEKMQQQSKKDETKWKLLVSKVIAAKNAVGSFSSRRSCLS
Download sequence
Identical sequences XP_007033652.2.67643 Tc04_g017120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]