SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc04_g028170 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc04_g028170
Domain Number 1 Region: 63-167
Classification Level Classification E-value
Superfamily POZ domain 1.07e-19
Family BTB/POZ domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tc04_g028170
Sequence length 883
Comment Putative uncharacterized protein
Sequence
MEPQFSRPRSYGPPTHQQQQQQQLKMTIPPLPQHSDNDRSSSELRAVDCNLNSLCEHIQM
EGFNGGSFSDIVVNAMGSTYHLHRLILSRSSYFRNMLHGPWKEAKAPMVTLNVDDNNVNG
EAIAIALAYLYGHHPKLNDNNAFRVLAAASFLDLQDLCAICTDFIISELWTSNFLAYQVF
AESQDYGIHGERVRNACWGYLCQSGAMELKEVLPKLSSQTLHALLTSDELWVHSEEKRFE
LALHTLLSKGAFYKTEHSDQGNSSPEMAIGIPPESSKAKGKDLVDSCPGKRLESELGCLS
LKGDLEHCNAAQNLLVELTECMVDIQTGVSSSEKQVPQPKYPQSEPIYPCNMDQSSSMNN
SFSDAEGIRTSCSYVEMPIGVGTSGLGASGMAMEGPSEEGSCYHLNNDNWLASDQSRNCS
SVDSSCSGIMLNDWGRCGMASLSWGGRVVGKRQVKSYAKGNCGIRGEEYDAFVNIFEGGS
LLYCNMSFEELLNVRKQLEELGFPCKAVNDGLWLQMLLSQRVQEVGADTCKNCCLTSMQC
ACRQPFGFPHGVATTGYYVQEHDQNHLTGNIGNVYVADNNQGEGSGLFRPVRVHVRGPID
GLAGIGRGATFVPAAAWPPTRFVFSRVPFGMGNRNGQQSLPNDDSEARADHNGDMSGGGL
TALVELSQGGSNATNVHGEQTERSYETDLQSRVPVTSAAAPATSGIAVQMLESPEHAIGI
EWENATSSSISLDMKTPLSHFPPFRFGVEFEDVHRLGDGQVKHSPEFFYAGSLWKVSVQA
FNDEDPQGRRTLGLFLHRRKAEITDSLRKVHMYVDSREKVTARYQLICPSKREVMVFGSF
KQRGTLLPKAPKGWGWRTALLFDELADLLQNGALRVAAVVQLV
Download sequence
Identical sequences XP_007035596.2.67643 Tc04_g028170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]