SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc05_g001900 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc05_g001900
Domain Number 1 Region: 783-954
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000455
Family Tetratricopeptide repeat (TPR) 0.0076
Further Details:      
 
Domain Number 2 Region: 443-496,527-607,680-729
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000461
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 
Domain Number 3 Region: 236-338
Classification Level Classification E-value
Superfamily POZ domain 0.000000141
Family BTB/POZ domain 0.015
Further Details:      
 
Weak hits

Sequence:  Tc05_g001900
Domain Number - Region: 358-413
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0216
Family BCR-homology GTPase activation domain (BH-domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc05_g001900
Sequence length 965
Comment Ethylene-overproduction protein 1
Sequence
MQHNIFTTMRSLKLIDGCKGTQVYALNTTGGGGGGGTTAGSGAGGVGEKLFHQLQDHLRA
NSIRSKSSRNYQASNTPAVVTETLLPYGLPVSDLLEPQIESCLKFVDFIETIADVYRRIE
NCPQFEKSGMFIEECAIFRGLSDPKLFRRSLRSARQHAVDVHSKIVLAAWLRYERREDEL
VGTSSMDCCGRNIECPKATLVAGYNPESIYDPCICSRTPQGEFDDDLSVADEECSTSDDS
GDMSFCIGDDEIRCIRSNIASLSTPFRTMLCGGFRESRRERINFTNNGISAEGMRAAEVY
SRTKRLDCFDPQIVLELLSFSNRFCCDNLKSACDAYLASLVNEMEDALLLIEHGLAENAY
LLVAACLQVFLRELPNSMHSPNVMKLFCNSDARERLAQVGHASFLLYYFLSQIAMEEDMK
SNTTVMLLERLTECATESWQKQLAYHQLGVVMLERKEYKDAQNWFETAFKSGHIYSLVGA
ARAKFKRGHKYSAYKLINSLISDYKPVGWMYQERSLYCSGKEKMLDLEMATELDPTLSFP
YKYRAVSLLEVNKIGAAISEINKIIGFKVSPDCLELRAWISIAMEDYEGALRDVRALLTL
EPNYMMFHGKMHGDHLVELLCPLVQQWSQADCWMQLYDRWSSVDDIGSLAVVHHMLANDP
GKSLLRFRQSLLLLRLNCQKAAMRSLRLARNHSTSEHERLVYEGWILYDTGHREEALAKA
EESISIQRSFEAFFLKAYALADSSLDQESSLYVIQLLEDALRCPSDGLRKGQVSIFFGVI
DSIYISALNNLGSVYVDCEKLDLAADCYMNALNIKHTRAHQGLARVFHLKNQRKAAYDEM
TKLIEKARNNASAYEKRSEYCDRDMAKSDLIMATQLDPLRTYPYRYRAAVLMDDHKENEA
IAELTKALAFKPDLQLLHLRAAFHDSMGAYISAVRDCEAALCLDPNHTETLELYNKVRDQ
VKEQK
Download sequence
Identical sequences Tc05_g001900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]