SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc05_g003230 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc05_g003230
Domain Number 1 Region: 107-224
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 1.44e-17
Family N-utilization substance G protein NusG, N-terminal domain 0.0023
Further Details:      
 
Domain Number 2 Region: 288-338
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.000000014
Family N-utilization substance G protein NusG, C-terminal domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc05_g003230
Sequence length 343
Comment Predicted protein
Sequence
MKQGLLLWSPCYLSPLSFHSLSHRIPSTKHAPQLPPISASIDSTDTQQRQQQLSARERRQ
LRNERRESKAGYSWREEVEERLIKKPKKRYTSWTEELNLDNLAHLGPQWWVVRVARIRGL
ETAEVVARSLARNFPDIEFKMYTPAVQEKKRLKNGSISIKPKPLFPGCVFLKCVLNKEIH
DFIRECDGVGGFVGSKVGNTKRQINKPRPVSDDDMEAIFKQAKEEQEKADQAFQEEQEGE
KTLTADKLNVEYNLDSNGVTTSILDSKPKRQSRKRYDTVANRAKSSKLVPGSMVRVVSGT
FAEFLGSLEKLNRKTGKATVGFTLFGKESLVELDVKDIVLETK
Download sequence
Identical sequences A0A061ESG1
XP_007026825.1.67643 CGD0021949 Tc05_g003230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]