SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc05_g017440 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Tc05_g017440
Domain Number - Region: 814-850
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00228
Family Rho termination factor, N-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tc05_g017440
Sequence length 856
Comment Putative Predicted protein
Sequence
MSDYDTKIRNLWLAASGARHSMKKKAGVAYNQDGNMVEENALNEKSCVQVLRILITKADT
EIDELEKDLVLLQSELAWAEHEEWSDICCNTLRAKIDCLDISIRKLRNKDENDIEFYLLM
HTEPVEKLNEIVKALLKSFFAEFDKHGRLLFVRQDVVVLDSSCGSPEQSADLHKNQKLRT
SDSHFIAKEEFNGPIVTPSKNCTSSKSYTEIEKKKANCSETVKIHVALPSHILMDDIVGL
QTLVAFMIEDIMRATACLTLVTHTVVDRVCNFWMELYPDAALFSAECWVQCDGSQPSLAT
TNVKNVIPHSLAPVADQFDEKKVVTNLDLETTKKQGIKDCGLTLKDKNVIQNSSSKSAQK
RMHEPDRAKVKEPAAQVVNNSGLDASKRSADHLNKKSASRLKIESEEATVHTSISASDIL
ILDSSSNPRGKRADLSRKVKDEQPANIIAKDFDSVACKQTTGHSNEMKMLCKHDLKVNGC
EVQEHYTTTIGKSKISNSCLNFEHKGNILKPANAVVKTISPDTLRHATGLNGKGNNSDSR
LGAVGQAESLNCDMEQKLCDFAVKSARKRGIKELKFASTEQKEPSNSFFKGEGKRKDSLQ
VVKRKKSPLSDNEHFALTSLLELQDERGKDKTILQMEGNPQLEEVRMAEIAARDDKLVMN
LYMRSQRGKLKIVKTTESISASVEEPSLNSKENVSNSSPILKGKRPWKYANNHTLNYSLS
GKITKKTVQHSQYQVEDQSMRLNASQNTMSLPQKKCKKFSSVPIFVEIRGSSVQMNISKL
HGNLNGSTAKTDISISEASVDGSCIKGVTPQPFDTSNLMKMKLCDLRAIAKAQKLTKYSG
LRKEDLVKQLENRFSC
Download sequence
Identical sequences Tc05_g017440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]