SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc05_g017800 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc05_g017800
Domain Number 1 Region: 274-358
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.24e-19
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 10-163
Classification Level Classification E-value
Superfamily POZ domain 6.98e-19
Family BTB/POZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc05_g017800
Sequence length 499
Comment Putative uncharacterized protein
Sequence
MSSFEESLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDP
PSGLDPVGSRMNPASAAAAGSRPGVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRPN
CSERACWHTHCTSAVDLALETLAAARYFGVEQLALLTQKQLASMVEKASIEDVMKVLIAS
RKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRLKSSLARRPLITHHHHHH
DLTSTADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKTL
LELGAADVNYRAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDILRTLT
SDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVISREEGSANAPTSTAIYPPMSDEHNSS
SSGSNLATLNLDSRLVYLNLGATGSTQMGSRMEGDDDSSHNSQREAMNRHDPTMYHHSHD
FYSLEMGIFFLSWDETTRI
Download sequence
Identical sequences Tc05_g017800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]