SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc05_g019630 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc05_g019630
Domain Number 1 Region: 57-132
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 9.94e-29
Family Skp1 dimerisation domain-like 0.0000398
Further Details:      
 
Domain Number 2 Region: 7-48
Classification Level Classification E-value
Superfamily POZ domain 0.0000000432
Family BTB/POZ domain 0.0019
Further Details:      
 
Domain Number 3 Region: 453-523
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000771
Family Ribonuclease H 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc05_g019630
Sequence length 524
Comment SKP1-like protein 11
Sequence
MASTSRKIRLMSSDGEAFEVKEAVAIPVPTVTSQIMAKVLEYCEKHTDKERIPENKLKAW
DADFVKVDQNTLFGLILAANYLNMKSLLHLTCQTVADMIEGKTPEEIRKVFNIKNDFSRE
EEEDVRRENQWAFDGIPLGANPRCSSTWDLVVNKFKQRLALWQRKYLSFGGKITLINSVL
NSLPLYYLSVFQAPKGGGNLDKHKILKVKWNTVCKPKRYGGLGISSLSHKNLALPYTRLF
SIATDKEARVHDIWHNGNWTISFCRNLYSWEVEFYSELLSLLGYIGLVSSKMDKLTRKYD
TRDNFSVKTFYSFLDADPISQISWLYSIWKLSIPSKVQSILWLASLDSIPSKAFLHWRGL
DFSSKQLCCTWCGYELETCSHNLLTCHFSWTVWCLVLQWWGISWSFPCTISSFLQSWASC
ALANDTHKRWMIVCGAMFWSLWLAQNESVFNNGLTKDKLGPAGCGGILCNSDGYVVGVFL
GPLGIQDSNFAELMAILHVVRFFSYSSFTSSKLIIEFDSKNALS
Download sequence
Identical sequences Tc05_g019630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]