SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc05_g021070 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc05_g021070
Domain Number 1 Region: 14-92
Classification Level Classification E-value
Superfamily POZ domain 0.000000385
Family BTB/POZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc05_g021070
Sequence length 557
Comment Putative BTB/POZ domain-containing protein At1g30440
Sequence
MSKPAPSTELEAHLGSVPFTLDKELLASKSAKVAALLKENSHESLSYLLRDIPADAETFE
LVARFCHGYEVHMSTENIVPLICLSFYLGMDENHSSNNLLSKAVTFFEQRVLPSWNEVIK
ALHVSEKFLQQTMQLGLFDACLQTIIAKASDNPRLLGEPIKLSTNYNDTEDGDDSYRPNA
RRRLFVLDWQEGLTTLPLQLYEPIIYAMNQHEIPPEYISASIYQYAKKWIFSCDIGVETT
SIYKRKSQRNVIETLERLLPHGRELLPCTLLFEMLRGAIDLEASSACRNGLEIRIGKQLD
QAKVKDLLIPSQGYTKEVQYDIEYIRRILKIFYGNYKSSDVSGLIIVAELVEEFLAEIAG
DTDLMIDTFISLAEMSMAAALGIQRNSDGIYRAIDIYLDKHTYLTEKEKEHVCRVLDFRK
LSPEACEHAAKNERLPVRVVVQVLFMAQLQLRDTLTKEVRGYDDKLGKEEEEEEANMGCR
EDKVRMEMEKMSIKVKELEKECNVMKKEITSSNSRQKVKKGKVNMWKEMKRKFGCMSSMN
DFHCQVKKKKVHPKLGI
Download sequence
Identical sequences Tc05_g021070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]