SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc05_g023590 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc05_g023590
Domain Number 1 Region: 493-620
Classification Level Classification E-value
Superfamily TRAF domain-like 3.27e-31
Family MATH domain 0.00066
Further Details:      
 
Domain Number 2 Region: 633-763
Classification Level Classification E-value
Superfamily POZ domain 5.23e-28
Family BTB/POZ domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc05_g023590
Sequence length 888
Comment Putative Speckle-type POZ protein
Sequence
MVAFSSPLLLFFFLFPLLFLARASHVTTHFKGIDLASPALDVTPTPLSGHSSVRGSKDVL
LCDRVQVSGQPRLKLGSYASCFRVTLAPSVLIPERLHSKIQVCFHQNASLGLCKCENDDW
KAVQKGIWHTVMSPYDDRYIDVKFIGEVSGSVTVAVEEDFQQWRLFFLALGFVLLLLAPF
VSSWVPFYYSSSMAIGIFLVIIILLFQGMKLLPTGRKNIFYLTVYVPMLGAGSFLLHQLS
ALVNSILVNFGLSEEMHNPVAIFVLVGIILSGAALGYWIVRKFVISKDGSVDVGVAQFVK
WAMRILATTFIFQSTLDTQLAMVAVASCSAICYLITSAKRNGHMHQPRSGYGSPWLHQSR
QGTIKHGRAEFFSRSPRMDSNRKVWNSPKTSPVWSNSPVKGVVSSPLGEAAIDHQDYYST
FHKTRYRKKFTKQEWEDFSRESTRHALAQLAASPEFTDWMTEHAGRIKLLPCDSSDESVG
SKTSSTDEDNEGSYSLAKGMGVGKHIASESFTVGGYQWAIYFYPDGKNPEDNSTYVSVFV
ALASEGTDVRALFELTLLDQSGKGKHKVHSHFDRALESGPYTLKYRGSMWGYKRFFRRAM
LETSDFLKDDCLKINCTVGVVVSEIDCPRLHPIQVPESDIGAHFGMLLENEEGSDITFNV
FGEKFHAHKLVLASRSPVFEAEFSDRMEEDNNEIVVTDMEPKVFKALLHFIYRDTLIDDE
EFLGTSSSCMPSVSDALASKLLAAADKYDLPRLRLMCESVLCKDISVNSVANILALADRY
HAMDLKSVCLKFAAENLVAVMRSDGFEYLKENCPSLQSELLKTVAGCEEEFSGGGKSRSV
WAQFSDGGDTIDRSVRQQTWENGGEQNRGLWVQLEGGDAGEGSPRQEE
Download sequence
Identical sequences Tc05_g023590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]