SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc06_g009460 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc06_g009460
Domain Number 1 Region: 75-150
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 4.05e-31
Family Skp1 dimerisation domain-like 0.0000391
Further Details:      
 
Domain Number 2 Region: 7-67
Classification Level Classification E-value
Superfamily POZ domain 9.42e-20
Family BTB/POZ domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc06_g009460
Sequence length 152
Comment SKP1-like protein 1A
Sequence
MASTSKKIILRSSDGETVEVEEAVAVELQTIKHMIEDDCADNEIPIPNVTSEILAKVLEY
CKKHVDKGKMGEDELKAWDADFVKVDQNILYHLVLAANYLNIQSLLDLICQTVADMIKGK
TPEEIRKTFNIENDFTPEEEEEIRRENQWAFE
Download sequence
Identical sequences Tc06_g009460 XP_007024458.2.67643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]