SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc06_g011480 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc06_g011480
Domain Number 1 Region: 52-188
Classification Level Classification E-value
Superfamily POZ domain 2.15e-16
Family BTB/POZ domain 0.025
Further Details:      
 
Domain Number 2 Region: 271-373
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000117
Family Ankyrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tc06_g011480
Sequence length 587
Comment Putative Regulatory protein NPR1
Sequence
MAYLSEPSSSLSFSSSSHLSNGSITHNIPSFTVPETGASLEVISLTKLSTSLEQLVNDNG
PDFSDADIVVEDVPVGVHRCILAVRSKFFNELFKKGNGSCEKEGKPSYNMSELLPYGKIG
LEAFRILLHYLYTGKLRPSPMEVSTCVDNVCAHDACRPAINFAVELMYASSIFQIPELVS
LFQRRLLNFVEKALVEDIITILVVAFHCQCSQLVSQCVDRVARSDLDSISIEKELPYEVA
ESIRLLRRKSPPDGEDNEVVVDPLREKRIRRIHKALDSDDVELVKLLLTESDITLDDAAA
LHYAAAYCDPKVVSEVLGLRLADVNLRNSRGYTVLHIAAMRKEPSVIMSLLAKGASASEL
TVDGRSAVNICQRLTRPKDYHAKTEQGKETNKDRICIDVLEREMRRNPMAGDVSVTSHTL
ADDLHMRLLYLENRVAFARLLFPSEAKLAMDIAHAETTSEFAGLCASKGSNGNLRQVDLN
ETPIMQKKRLLARMEALMKTVEMGRRYFPHCSEVLDKFMEDDLPDLFYLEKGSSEEQKIK
RSRFRELKDDVQKAFSKDKAEFNRTGLSSSSSSSSLKDGGPYKLRKL
Download sequence
Identical sequences A0A061GK77
Tc06_g011480 XP_007024872.1.67643 CGD0025430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]