SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc06_g012680 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc06_g012680
Domain Number 1 Region: 4-144
Classification Level Classification E-value
Superfamily At5g01610-like 9.42e-36
Family At5g01610-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tc06_g012680
Sequence length 146
Comment Predicted protein
Sequence
MALQQIATNREAAEIYQGAALCKQKSMELLGEFHLPKGLMPLDNLVEVGYNRTTGFVWLK
QQKSLEYRFKAIGKTVSYEPEMTAFVEDRRMRRLTGVKSKELLIWVSVSDIFIDKSNPSK
ITFANSTGLSRSFPVAAFEAEGEGRN
Download sequence
Identical sequences A0A061GF08
Tc06_g012680 XP_007025085.1.67643 CGD0026474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]