SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc06_g017960 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc06_g017960
Domain Number 1 Region: 3-92
Classification Level Classification E-value
Superfamily POZ domain 0.000000000102
Family BTB/POZ domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc06_g017960
Sequence length 537
Comment Putative BTB/POZ domain-containing protein At5g48800
Sequence
MQVFCDLQVDVNGEEVFMVDKRTLASFSGRFSKLFGNLKEDSRNLKVVFHDFPGGAEGFE
LVARFCYNEGRTEITPANVVLLNCAARFMEMESDGLRPSLLNQTKKSLDGISFWSWSELL
VALKECQDLLSASSSSIILDKVLDCVLGRIASPIVASSYTSSSENSSFKCSSDTRSSYSW
RNNFSQVSWWFEDLLFLNIDIIDRVIKMMIRQRFDHPTISKFLFCYQRSRFLNASPTQKC
KVTEVIIKLFSLLDRSSLSCKLLFDIFRVASSLKISKYCKSILENLIGSQLDQATIDFLL
LPSPQRKGYMYDVNLVLRLVKAFCNEGRSCCLSPVRLRKVASLVDSYLVEVAADFHLNPS
KFGALVMLLPDSARESHDRLFQAIDIYLEVHGGLHEAEKMGICCALNYAKLSTDALRHLA
RNSKFPSRIAIQAFINQQSKLENLLEGQKHLDTFSGSLSAEESINEKENSDQMLLYAKRL
NLPRKAEQLDVQLQGMQCRVTELEKFCGIMQTQIGNIPRTRLSSLGNNARFLPKLCS
Download sequence
Identical sequences Tc06_g017960 XP_007025901.2.67643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]