SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc06_g021090 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc06_g021090
Domain Number 1 Region: 42-87,138-195
Classification Level Classification E-value
Superfamily POZ domain 0.0000000322
Family BTB/POZ domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc06_g021090
Sequence length 659
Comment Root phototropism protein, putative
Sequence
MKFMKIGTKPDTFYTEEATRYNKCDYPYFTQLATITSFKSNRVGDWQRRTVISDIPSDLT
IRINNICYLLHKSAFWRRSRVQHVISVKKTDGFTWYTQHDRAEVDSPLLRTENISNRKVP
ERQFPLVPTCGLLQRLCSDSEDSDIVIIDLHDIPGGEDAFELCAKFCYGITISLSAHNFV
PAFCAAKFLRMTESIEKGNFVLKLEAFFNSCILEGWKDSIVTLQTTIKLPEWSENLGIIR
RCIDSIVEKILTPPAKVSWSYTYTRPGYVKKQHQSVPKDWWTEDISDLDIDLFRCIITAV
RSTYMLPPQLVGEALHVYACRWLPDTTKSRPPQSSGSLTEESMKKSRRILEFIVSMIPAD
RGSVSVGFLLRLLSIANYLGASPVTKTELIRKAGLQFEEATVGDMLLPSQLSSDQHYYDI
DLVSAVLESYLVLWRRQSPASAENSHLLRSVRKIGKLIDSYLQVVARDVNMPISKLVYLA
EALPDSARGDHDGLYKAINIYLKEHPDLSKAEKKSLCRMLDCQKLSPEIRAHAVKNERLP
LRTVVQVLFFEQESGSRATGHKPELISKARQTQATEEEGDKPQQEARRRNTVPESSEREH
HEKMKSLEGKGVRGNIGEAESEKGKERRGEANSASKVDPKKIVQRRSRSDQGHDKGRER
Download sequence
Identical sequences Tc06_g021090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]