SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc07_g000510 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc07_g000510
Domain Number 1 Region: 147-259
Classification Level Classification E-value
Superfamily POZ domain 6.28e-26
Family BTB/POZ domain 0.01
Further Details:      
 
Domain Number 2 Region: 16-85
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000085
Family MATH domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc07_g000510
Sequence length 328
Comment Predicted protein
Sequence
MSESAYRVETTARLAQWRIDNFASCNYRKSDPFKIGKWNWHLLVERNRVLSVKLYPEISN
LTRENPPIASFIIRVVCSTGDRRAFTHPEITDKQLKINDDFVWQIEVPLTGKFIIDVEFL
DLKTASPNGGEPCSIWAEGFTEKQSNATALACLGRMLTEGIHTDIIINASDGSIGTHRAV
LAARSPVFRSMFSHNLKEKELSTINISDMSIEACQAFLSYIYGNIKHEEFLTHRLALLRA
ADKYDIADLKEACHESLLEDIDTKNVLERLQNAALYQLPKLKSSCMRYLVRFGKIYDIRD
DFNAFLQCADRELIADVFHEVLNTWKGF
Download sequence
Identical sequences XP_017979521.1.67643 Tc07_g000510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]