SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc07_g014670 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc07_g014670
Domain Number 1 Region: 50-350,427-548
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000033
Family MIF4G domain-like 0.059
Further Details:      
 
Domain Number 2 Region: 867-976
Classification Level Classification E-value
Superfamily POZ domain 0.0000000345
Family BTB/POZ domain 0.032
Further Details:      
 
Domain Number 3 Region: 688-818
Classification Level Classification E-value
Superfamily POZ domain 0.000000604
Family BTB/POZ domain 0.041
Further Details:      
 
Weak hits

Sequence:  Tc07_g014670
Domain Number - Region: 500-590,626-690
Classification Level Classification E-value
Superfamily ARM repeat 0.00486
Family HspBP1 domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc07_g014670
Sequence length 1051
Comment Putative uncharacterized protein
Sequence
MKSTKRGAAADSNRGSSSSGHLHTLHQRLKHALSLGNTRLCDDKEKKWQCTDIEIQRHVI
RSLAAFLDCISGDASHHRLLKGVENDQYAVLCVFIHATVFGSGKYILILLEDSLADIVGA
LVWILQCKSGAIVGMAANMVVKLIGTNSSMMQLYLADLINPLSSLLCSKNVEVSTSCATA
LNMILSNLSVKSEKEVWEIVKEAKTVIQIIRIMREFPGGTLSIEYFQEMASLLSMILWQW
PPSRYSVWNDPIMMKVLEDSCTKSNVSTKVAVLKLYSALALCNIVAKKLLENGETILPMM
VNSMGGSEPLSIRIEGFRLAQHLVADEHRCKIMTSLHSGPLVKAIIGGMRGWSLVSGKIA
NDQLSLLEEACRLARITRWPGEHHICFWEEGIDKVLLDLLLENFDKQASEHPLSREEQMS
IAQEGLDANFLLALRPHIWEILGWLALHCAKDFRPSAHRNELYVDILITCACVSFVEAIR
KGCQICENGDTYRIESSSRSVLMMMHSPSTYIASKVRLILSGVLEPKGNEYLKRLLHLLK
YSSSTNNYGLPNIHKTVIELVGLICYSGLPQYQKNVIGGDGMKTLVTLIGRCLRNQVSIR
SRSVAPHFHSAFYERACCWMTTEEWEGKDALLFYSLWGLAELVQHSSDINHTKSHLVETV
QDVLHNVSASGPRWFAAYILSYFGVYGFPNKHDKGFGKALEDKEHTDVQLFFANGESVSA
HGVILAVRCPSLLPLEQFPHHVKATDNFRVRDIPEKLCPKFRKEIRLSANVDQQALLKLL
DYVYFGYLEAGEELARKLKTLAKCCNLQPLFLMLCRKIPKWGTPIPSSDLIHALGPVGFH
FVDVILEAKATERRPWACSFCSLLVPHMHAHKIILQSSCNYLRALFQSGMQERSLSMRLQ
SLLCHSQIIKVPISWEALIKLVQWFYSSELPNPPFGCLWDNMDIKERLYELKPYVELYWL
AEFWILEDVQDACFRIVVCCLDSDRQLSIEVIKLAANFSLWKLVEVAAEYMAPLYHKLRD
TGDLEELDELLVDLVRDASVRLSQDRGNLSG
Download sequence
Identical sequences Tc07_g014670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]