SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc08_g004960 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc08_g004960
Domain Number 1 Region: 333-448
Classification Level Classification E-value
Superfamily POZ domain 6.02e-22
Family BTB/POZ domain 0.0054
Further Details:      
 
Domain Number 2 Region: 197-296
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000217
Family BTB/POZ domain 0.017
Further Details:      
 
Domain Number 3 Region: 649-804
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000482
Family Galactose-binding domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc08_g004960
Sequence length 805
Comment Predicted protein
Sequence
MEKKEKKFLTVAPFECAWRKDLKFREAGRGCVAFDAFAHNDVTVVFRENVGSQHYHYKRD
NSPHYTVIIGSHRNRRLKIEVDGKTVVDAAGVGLCCSSAFQSYWISIYDGLISIGKGRYP
FQNLVFQWLDSNPNCSVQYVGLSSWDKHVGYRNVNVLPLMQNHLLLWKQVDCGEYNGEDD
GDEELENEKMGYEKWGLENFLESWELSDMFFIVGEEERAVPAHKVILQASGNFSLSSSDG
DVVQLQHVAYPILHALLQYVYAGQTQISEAQLWPLWALSLQFEVMPLVKQCEEAMERFKV
NKKLFDSGKNVELSYASSQPHSGGTFSSGHPINMQRLQQLHSTGEYSDINIYIEGQGLIA
RAHKVILGFYSVPFAKMFTNGMCESNTPEVCLKDVSSEALKAMLEFMYSGELRIEDTEDF
GTLLLQLLLLSDKFGISLLHQECCKMLLECLSEGSVCPILQVVASIPSCKLIEETCERKF
AMHFDYCTTASLDFISLDETTFRNIIQHPDLTVTSEERVLDAILMWCMKAEKLCGWELVN
ELMINSTSESLFKERLQSVDDLLPSVRFSLLPYPLIKKLENTSLSRHISAFGDLVTEAIN
YKECTVTIHGNDQNVKFQHRRSSYKELQYICDGDSNGILYFAGTSYGEHPWVNPVLSKRI
AITASSPTSRYTDPKVLVSRTYQGTCFAGPRMEGGRICAWWMIDIGQDHQLICNYYTLRQ
DGSRAYIRCWKIQGSVDGRSWIDLRVHENDQTMCKPGQFASWPVTGTNALLPFRFFRVLL
TGPTTDSSHPWNFCICFLELYGYYR
Download sequence
Identical sequences A0A061FD71
XP_017981374.1.67643 CGD0029881 Tc08_g004960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]