SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc08_g010690 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc08_g010690
Domain Number 1 Region: 75-261,291-321,449-496
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.29e-68
Family Tandem AAA-ATPase domain 0.000000435
Further Details:      
 
Domain Number 2 Region: 498-606,702-786
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.11e-42
Family Tandem AAA-ATPase domain 0.0000309
Further Details:      
 
Domain Number 3 Region: 320-440
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 3.53e-36
Family Pre-protein crosslinking domain of SecA 0.0000958
Further Details:      
 
Domain Number 4 Region: 808-941,1016-1089
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 3.58e-35
Family Helical scaffold and wing domains of SecA 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc08_g010690
Sequence length 1102
Comment Putative Protein translocase subunit secA
Sequence
MATLPSLLNASFLTPKPLPQRETLLCTKPTSSFLFPSSSPSFFSLRRQHINIQTPIAASL
KEDVGRFKKTLGDFISLNYWVVRDYYRLVDFVNALEPEIQRLSDEQLTAKTSEFKKRLSQ
GDNISDIQAEAFAVVREAARRKLGMRHFDVQIIGGAVLHDGSIAEMKTGEGKTLVSTLAA
YLNALTGDGVHVVTVNDYLAQRDAEWMGRVHRFLGLSVGLIQKGMTAEERRINYQCDITY
TNNSELGFDYLRDNLAGNSDQLVMRWYVSEHYFNLVFDFFYWTTSDKLCKNRPKPFHFAI
VDEVDSVLIDEGRNPLLISGEASKDAARYPVAAKVAELLTRGLHYNVELKDNSVELTEEG
IALAELALETNDLWDENDPWARFVMNALKAKEFYRRDVQYIVRNGKALIINELTGRVEEK
RRWSEGIHQAVEAKEGLKIQVDNDVCKADSVVVAQITYQSLFKLYPKLSGMTGTAKTEER
EFLKMFQMPVIEVPTNLPNIRKDLPIQAFATARGKWEYVSQEVEYMFRQGRPVLVGTTSV
ENSEYLSDLLKERNIPHNVLNARPKYAAREAEIIAQAGRKYAITISTNMAGRGTDIILGG
NPKMLAREIIEDSLLSFLTREAPNLEADDMGISKKVLSKIKVGPSSMALLAKAALMAKYV
GKSEGKSWTYQEAKSIISESVEMSQSMPLKELRKLIDEQSEMYPLGPSIAITYLSVLKDC
EVHCTKEGFEVKRLGGLHVIGTSLHESRRIDNQLRGRAGRQGDPGSTRFMVSLQDEMFQK
FNFDTEWAVKLISKITNDEDIPIEGDAIVKQLLALQINAEKYFFNIRKSLVEFDEVLEVQ
RKHVYDLRQLILTGDNESCSQHIFQYMQAVVDEIVFGNADPLQVVSFHPEMLSTPHPRYW
SLAKLLKEFIAIAGKLLDDSFASITEEDLLQSLKQLHESNSVDIDNLHLPNLPKPPDCFR
GIRRKISSLKRWLAICSDDSTKNGRYRPTTNILRKYLGDILIASYLNIVEESGYDDAYIK
EIERAVLVKTLDCFWRDHLVNMNRLSSAVNVRSFGHRNPLEEYKIDGCRFFISMLSATRR
LTVESLLHYWSSPMESQELFLS
Download sequence
Identical sequences Tc08_g010690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]