SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc09_g001440 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc09_g001440
Domain Number 1 Region: 22-116
Classification Level Classification E-value
Superfamily POZ domain 3.77e-18
Family BTB/POZ domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tc09_g001440
Sequence length 615
Comment Putative Coleoptile phototropism protein 1
Sequence
MKFMKLGSKPDAFQADGKCIRYVTSDLATDVTITVGEVKFYLHKFPLLSKSNRLQKLVLK
ASEENCDEINMVDFPGGPKAFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMTEDVDRGN
LIFKIEVFLNSSIFRSWKDSIIVLQTTKSLIPWSENLKIVGRCIDSIASKTSVDPANITW
SYTYNRKLSVPDKIVDDGMKFREKVESVPKDWWVEDICELEIDLYKRVMTAVKSKGRMDG
AVIGEALKTYAVRWLPDSVNALVSDAHSWRNKLLVETIVCLLPSDKAVGCSCGFLLKLLK
VAILVGVDDSAKEDLVKRISLKLHEASVKDLLIPARSPQTTLYDVEMVQSIVNRYIMNEK
RTQDLDVEKNEMGCADFVLGHGSLLSVGKLIDGYLEEIARDPNLSLASLIDLSQSIPECA
RPVHDGLYKAIDMYLKEHPSLTKAERKKLCGLMDVKKFTMDASMHAAQNERLPLRVVVQV
LFFEQVRAAAGVQSLANNPRDISHSTTNTDEEWEKTAAEDCNSLKKQMSQMKVKEDGFQK
NGKLAKKNSKNSKSGMQLLPSRSRRIFDKLWVVGKGHTENRSSETSGSSQSPTSMVPGDT
KSSGSSSRHRRHSIS
Download sequence
Identical sequences Tc09_g001440 XP_017983455.1.67643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]