SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc09_g007660 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc09_g007660
Domain Number 1 Region: 264-368
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.29e-17
Family Ankyrin repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 47-187
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000746
Family BTB/POZ domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc09_g007660
Sequence length 591
Comment Regulatory protein NPR1
Sequence
MDNRNGFSDSNEISNNSSTCCIAAATNSETLASSEPLNTPAIAALQILSRNLESVFESTD
SDSLYSDAKIGLSSGREVPVHRCILSARSSVFKTVFSGLKDRGAKFELKELARDYEIGYD
SLVAVLAYLYSGRVRSLPRGVCVCVDDDCSHLACRPAVDFVAEVLYAAFTFQVSELISLY
QRHLLDIIDKVEMDDILVVLYVANMCGNTCERLLAKCIETLVKSDVDIVTLDKALPYHIV
KQIMDSRLELGLDKPENTGFPDKHVKRIHRALDSDDVELVRMLLKEGHTNLDEASALHYA
VAYCDAKTTTELLDLGLADVNRRNSRGYTVLHVAAMRKEPKIIVSLLTKGARPSDLTLDG
RKAFQISKRLTRAADYYMSTEEGKASPKDRLCVEILEQAERRDPLLGEASLSLAMAGDDL
RMKLLYLENRVGLAKLLFPMEAKVAMDIAKVDGTSEFTLASINSNKLNDAQRTTVDLNEA
PFRIQEEHLNRLKALSRTVELGKRFFPRCSEVLNKIMDADDLSQLACGGNDTPEERLVKK
QRYVELQDVLSKAFNEDKVEFDRSTISSSSSSKSIGVSRPNGKLTGSGRGG
Download sequence
Identical sequences Tc09_g007660 XP_007012790.2.67643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]