SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc09_g024050 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc09_g024050
Domain Number 1 Region: 16-115
Classification Level Classification E-value
Superfamily POZ domain 1.1e-16
Family BTB/POZ domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tc09_g024050
Sequence length 631
Comment BTB/POZ domain-containing protein At1g30440
Sequence
MACMKLGSKTDAFRRQGQAWFCTTGLPSDIVVEVGEMSFHLHKFPLLSRSGVMERLIAEA
SEEGEEKCSINLPDIPGGAKTFELVGKFCYGVKLELTASNVVYLRCAAEHLEMTEEYGEG
NLITQTETFLNQVVLRNWKDSLRALQTCDDIISHAEELNITKRCIESLAMKASTDPNLFG
WPIMEHGGPMQSPGGSVLWNGISTGARPKNTSSDWWYEDSSTLSLPLYKRLIAVMDSRGI
RQEIISGSLTFYAKKYLPGLNRRQGANDSNSSARLAPVALGAAPSEEDQKLLLEEIDRLL
PIQKGLVPTKFLFGLLRTAMILRASPSCISNFEKRIGMQLDQATLEDLLMPNFSYSMETL
YNVDCVQRILEHFLAMDQITGGASPCSVDDGQIIGSPSLTPITMVAKLIDGYLAEVAPDI
NLKLPKFQALAASVPDYARPLDDGLYRAIDIYLKSHPWLSESDREQLCRLMDCQKLSLEA
CTHAAQNERLPLRIVVQVLFFEQLQLRTSIAGCFLVSDNLDGSRQLRSGFAGSTEGGWAS
AVRENQVLKVGMDNMRMRVSELEKECSNMRQEIEKLGRGKGSSTWGNVSKKFGFRLKSQM
CSAQEGSVSNQNNGSGKIEKVKDRQGKLKKN
Download sequence
Identical sequences Tc09_g024050 XP_017983502.1.67643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]