SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc09_g026860 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc09_g026860
Domain Number 1 Region: 30-169
Classification Level Classification E-value
Superfamily TRAF domain-like 2.29e-35
Family MATH domain 0.00063
Further Details:      
 
Domain Number 2 Region: 181-314
Classification Level Classification E-value
Superfamily POZ domain 4.4e-30
Family BTB/POZ domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc09_g026860
Sequence length 407
Comment Putative Speckle-type POZ protein
Sequence
MTNRATSPTATAEVEQSPLVSPTSSRSVTETVNGSHRLVIQGYSLAKGIGVGKHIASDNF
TVGGYQWAIYFYPDGKNPEDNSTYVSVFIALASEGTDVRALFELTLVDQSGKGKHKVHSH
FDRSLESGPYSLKYRGSMWGYKRFFRRALLETSDYLKDDCLKINCTVGVVVSAIDCSRLH
SIQVPESNIGAHFGMLLENMEGSDITFDVAGEKFHAHKLVLAARSPVFRSEFFDGMDEEK
QEIVITNFDPKVFKALLHFIYRDTLSEDVESVGSTFSSVSSISETLIAKLLAAADRYGLE
RLKLMCESHLCKNISVNSVAKILALADQYHASELKAVCLRFAAENLAAVMRTDGFEYLKE
NCPSLQSELLKTVAGCDEDRSSGGKSRSVWAQLSDGDTSGRRVRQRT
Download sequence
Identical sequences A0A061GTM1
XP_007015536.1.67643 Tc09_g026860 CGD0033986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]