SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc09_g030230 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc09_g030230
Domain Number 1 Region: 20-91
Classification Level Classification E-value
Superfamily TSP9-like 8.37e-25
Family TSP9-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc09_g030230
Sequence length 91
Comment Putative uncharacterized protein
Sequence
MASLLISFAPSTTRVFAATAAKGAGGSKEEKGLFDWILGQLQKEEQFYETDPILQKVEGK
NDDGTSSGRKNSVSVPQKKKGGGFGGLFAKK
Download sequence
Identical sequences XP_007016156.2.67643 Tc09_g030230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]