SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc09_g030960 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc09_g030960
Domain Number 1 Region: 6-97
Classification Level Classification E-value
Superfamily POZ domain 3.92e-31
Family BTB/POZ domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc09_g030960
Sequence length 98
Comment Putative Transcription elongation factor B polypeptide 1
Sequence
MKKEDTVKLISAEGMEFVIDKEAAMVSQTIRNMLTSPGSFAETEHGEVTFPEISAVILEK
ICQYFYWSLQYSRGKETEFYIEPELTLELMMAANYLHT
Download sequence
Identical sequences A0A061GZZ8
CGD0034484 XP_007016290.1.67643 Tc09_g030960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]