SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc09_g034330 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc09_g034330
Domain Number 1 Region: 641-711,752-879
Classification Level Classification E-value
Superfamily TPR-like 4.74e-18
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 
Domain Number 2 Region: 209-314
Classification Level Classification E-value
Superfamily POZ domain 0.00000000149
Family BTB/POZ domain 0.0095
Further Details:      
 
Domain Number 3 Region: 413-458,506-585
Classification Level Classification E-value
Superfamily TPR-like 0.0000011
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc09_g034330
Sequence length 938
Comment Ethylene-overproduction protein 1
Sequence
MRGIKLIERFKSTQVHALNPPDTTVVNTTGSSSTAGKLNNHRVKFIGSKLKSNKASSVSA
AKTLLPFGLPRADLLEPPIEPHLKQIQLVETLADLYRRFETCLESEKSLICIEQYSFLGS
LGDLKLLRRCLRVARQHAFDVHSKVVLSAWLRYERREDELDGVFPMDCSGFILECPKAAL
VSGYDPNTIYDHCKCYQECTKSADAQISKGNECLTLEEDSDISFYVCNEEINCIRFKIAA
LSSPFKTMLYGSFIESKSYKIDFSQNGISVEGMRAVDLYSRNRRVDLFSPEIVLELLSFA
NRFCCEEMKSACDIHLASLVSCIEDALVLIEYGLEERANVLVASCLQVLLRELPSSLYNP
KVMKIFCSFEARERLASAGHASFFLYYFLSQVAMEENMVSNATVMLLERLRECATEKWQK
ALALHQLGCVLLERKEYRSAQYCFEAATEAGHVYSLAGMARSKYKQGQQYSAYKLMSSLI
SEYKAVGWMYQERSLYNVGKDKIADLNIATELDPTLSFPYKYRAVSKAEEKQTRAAISEI
DRIIGFKLAPDCLELRAWFFIVIEDYGSALRDITALLTLEPNYRMFNEQISGDDLIELLN
HKVQQGSQADCWMQLYERWSSVDDIGSLAVIHQMLVNDPGKSLLRFRQSLLLLRLNCQKA
AMRCLRLAHNLSSSEHEKLVYEGWILYDTGNREEALARAEKSILIQRSFEAFFLKAYTLA
DSSLDPESSSYVIQLLEEALRCPSDGLRKGQALNNLGTIYVDCGKLDQAANCYMNALEIK
HTRAHQGLARVYLLRNQRKAAYDEMSKLIEKAHNKASAYEKRSEYCDREMAKNDLNMATK
LDPLRTYPYRYRAAVLMDDQKETEAVEELSKAIAFKPDLQMLHLRAAFYESIGDLNSALC
DCEAALCLDPNHMDTLDLYNRARDRATHPQENVRGMGS
Download sequence
Identical sequences XP_007016944.2.67643 Tc09_g034330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]