SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc09_g035320 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc09_g035320
Domain Number 1 Region: 6-114
Classification Level Classification E-value
Superfamily POZ domain 1.18e-19
Family BTB/POZ domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc09_g035320
Sequence length 576
Comment Root phototropism protein 2
Sequence
MATPVMSNSRMSSAMERTGQWVFSQEIPTDVVVEAGEANFNLHKFMLVAKSNYIRKLILE
TKEADLTRINLSDIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDNYCDSN
LAGRTEDFLSQVALHSLSGAVVVLKSCEDLLPMAEELKIVQRCIDIASARACSVANFPCR
TPPNWWTEELSILDVDLFGRIIAAMKQRGAKALTLASALITYAERWLRDLVRDHSGNGIK
CSEPTDSDLRIQQRELLESMVALFPAEKAAFPMHFLCCLLRCAIFLKASSACKNELEKRI
AVILEHVAVDDLLVLSFTYDGERLLDLDSVRRIISGFVEKEKSMAVFNGGNFREVTSSAM
QRVAKTVDAYLGEIATVDELTIAKFNGIAILVPKGARKVEDDLYRAIDIYLKAHPNLDEI
EREKVCSSMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGAVDDRERNAADAV
ATRNQLQADVSLVKENEALRSELKKMKMYISDLQKNNQGTCSKSAAGNRKPTFFSSMSKT
LGKLNPFRHGSKDTSHIDDSLGVDVTKPRRRRFSIS
Download sequence
Identical sequences XP_007017103.2.67643 Tc09_g035320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]