SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc10_g003020 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc10_g003020
Domain Number 1 Region: 14-153
Classification Level Classification E-value
Superfamily TRAF domain-like 2.29e-35
Family MATH domain 0.00054
Further Details:      
 
Domain Number 2 Region: 165-294
Classification Level Classification E-value
Superfamily POZ domain 2.67e-29
Family BTB/POZ domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc10_g003020
Sequence length 402
Comment Putative Speckle-type POZ protein
Sequence
MDDFKDSVSKSVSETVNGSHQFTIKGYSLAKGMGPGKCIASDVFTVGGFDWVIYFYPDGK
NPEDSAMYVSVFIALASEGTDVRALFELTLVDQSGKGKHKVHSHFDRALESGPYTLKYRG
SMWGYKRFFRRTTLETSDYIKDDCLIMNCTVGVVRTRLEGPKQCSISVPPSEMGQNLKAL
LESEVGCDIIFQVVDEKFKAHKLILAARSPVFRAQFFGLVGDPNMDKVVVEDFEPSIFKA
MLLFIYTDKLPDVQEITGSTSMCMSTNMVQHLLAAADLYNLDRLKVLCEAKLCEELNADT
VATTLALAEQHHCAQLKAICLKFAATPANLGAVMQSEGFRHLEECCPSLLSELLKTFASG
EESLSQLSSRKRSGSSVYGMDLAAEGPVAESVNPNGRRVRRR
Download sequence
Identical sequences A0A061FN45
Tc10_g003020 XP_017984993.1.67643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]