SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc10_g005650 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc10_g005650
Domain Number 1 Region: 15-144
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000322
Family BTB/POZ domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc10_g005650
Sequence length 656
Comment BTB/POZ domain-containing protein At1g30440
Sequence
MACIMRLGSKSEAFHLDGQTWLCSTGLSSDVIVEVGEMSFHLHKIVFSLSPSCHVYQFPL
LSRSRVIENLIKDYSGGDEKKCVLQFHDLPGGAKTFLLVAKFCYGIRFELTALTIVSLRC
AAEYLQMSEDHGEGNLIAQTENFLNEIFSNWTDSIKALETCEEVLPYAQELHIVSRCINS
LAMKACADLSLFGWPMSGSGTAAQSPEDTVLWNGISAAVKPPPVSEDWWYEDVSVLRLSL
YKRLILAVESSGIKPERIAGSLVHYAKKHLPLLGRQSSFQNWDHAASGSTVSALCDADQR
NLLEEIVALIPNQSGATPINFLLRLLRTSMILHASSSCQEKLEKQIGAQLDQAALEDLLI
PNMGYSVETLYDIDCVQRILDHFVLLDHEAVDSGSNYIVDEGQLMGGSHPMTPMTLVANL
VDGYLAEVAPDVNLKLPKFQSLAAVIPDYARPLDDGIYRAIDIYLKAHPWLTDSEREQIC
RLMNCQKLSLEASTHATQNERLPLRVIVQVLFFEQLRLRTSIAGWFFVSDNLGNSQNPSG
NLEIPRNNACAHVGTTQDHFLAVDDIMERVSELEKECLSMKEELEKLVKTKGGWNIFLKK
FSFKSKSKSCDPKTAKSSDSKKSKPYDSNTSATASFTNGRGNHNKGESGLQVLKEN
Download sequence
Identical sequences Tc10_g005650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]