SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc10_g006290 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc10_g006290
Domain Number 1 Region: 200-275
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.44e-21
Family Skp1 dimerisation domain-like 0.00017
Further Details:      
 
Domain Number 2 Region: 10-70
Classification Level Classification E-value
Superfamily POZ domain 1.22e-16
Family BTB/POZ domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc10_g006290
Sequence length 277
Comment Putative SKP1-like protein 4
Sequence
MSSSNNSGKVLKLKSKDNQIFEVEESVAIQSELIKNMVEAGCDIGVIPLLMVHSKTLRNV
IEWCQKHVDYVEENDNESNEEDVKNWESEICEEENNNGSDAEEIRNWESEICEEENNNGS
DEEEIRNWESEICEEENNNGSDEEEIRNWESEICEEENNGSDEEEIKNWESEENNDGSDK
EEVKNWESEDNNAGSDNDELKNWESKFVDIDKDSLYELLLAADYLNIDSLLDRVIKQVAD
MIKASRSVEEVRQTFGIKSDFTPEEEEEIRKEISWID
Download sequence
Identical sequences Tc10_g006290 XP_007009955.2.67643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]