SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc00_g050100 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc00_g050100
Domain Number 1 Region: 4-94
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000196
Family B3 DNA binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tc00_g050100
Sequence length 122
Comment Putative Predicted protein
Sequence
MAIVLKNLKKTDIEKRLTIPSKALRCFPPLSDKHMVDFAVRDEESGRVWKFRIYTRKKNN
NKYLKPVLTKGWREFVCSKQLRIGDRVAFYKQAGAVKYRVKVERPLKIFGASVFPSQESV
VC
Download sequence
Identical sequences Tc00_g050100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]