SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc00_g073790 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc00_g073790
Domain Number 1 Region: 61-193
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000298
Family BTB/POZ domain 0.06
Further Details:      
 
Domain Number 2 Region: 275-378
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000065
Family Ankyrin repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tc00_g073790
Sequence length 583
Comment Putative Regulatory protein NPR1
Sequence
MEYGNEISSPLSFAPSSYLSDGSGGHLIEAATSTEDPGANLEILSLSRLSCSLEKLLVDQ
EYDYSDAEIVVEGNIAVGVNRCILAARSQYFHELFRKGRDDNSMNKEGKPQYLMSELVPH
GRVGYEAFKVFLNYLYTGKVKPSPREVSTCMDDACAHDACGPLITYALELMYASATFQMK
ELVLLVQRHLLNSVGKALVEDVIPILVAAFHYKLNPLLYDCIQRVATSGLDDACLEKELP
GEVYHEIRSVRLKSHKQEAEPGAVELDPMLEKRIRRIHKALDSDDVELLRLLLTESNVTL
DDAYALHYAAAYCDPKVVNEVLSLGSANVNLRNPRGYTVLQVAARRKEPSVLVALLNKGA
YVAETTPDGQTAVAICRRLTRPKDYNENKKQGELSNKDRLCIDVLEREMRNSVESYNQGV
SSQVMHDDLHMKLDYYENRVSFARLLFPAEAKLAMEIADADSNIREVNLNESPSIQTKRL
QLRLQTLLRTVETGRRYFPLCSDVLDKFLVDDMSDPSLVEEGSSEEQRLKKRRFTELKEE
LQQAFYKDIEQKKRSTLSPSCSASSSTAKEGAAAAPRHKTRRK
Download sequence
Identical sequences XP_007048936.2.67643 Tc00_g073790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]