SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc01_g005520 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc01_g005520
Domain Number 1 Region: 394-655
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.32e-49
Family Protein kinases, catalytic subunit 0.00039
Further Details:      
 
Domain Number 2 Region: 57-234
Classification Level Classification E-value
Superfamily L domain-like 2.46e-25
Family Polygalacturonase inhibiting protein PGIP 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc01_g005520
Sequence length 752
Comment Probable inactive receptor kinase At5g67200
Sequence
MPKANSQAFLPLFFFFLFFWTCFSKPITYPRQTNLLLPSDAISILSFKSKADLDNKLLYA
LNERFDYCQWRGVKCAQGRVVRYILQNSGLRGIFSANSLTRLDQLRVLSLHNNSLSGPIP
DLSSLYNLKSLFLDRNNFSGAFPPSILLLHRITSLDLSYNDLTGPIPANLTALDRLNILR
LQWNRFNGTLPPLNQSFLLIFNVSGNNLTGKIPVTPTLSKFNTTAFSLNPNLCGEIINKA
CTSRAPFFGSSSASGPLGQSAEARGGGGGGGATGGIVVLPPPSSPKKHQRTGVVLGFTIG
IALIIFSVLLALALVRKQSGKKRVESKETKPTTASLEVTNSNLGNSKTQVVEEVSDRKIV
IPEIQKLKKSGNLVFVAGEVEGYSLEQLMRASAELLGRGTMGTTYKAVLDGKLILTVKRL
DAGKTAVTSGEVFERHMDAVGGLRHPNLVPIRAYFQAKGERLVIYDYQPNGSVFNLVHGS
RSTRAKPLHWTSCLKIAEDVAQGLAYIHQASRLVHGNLKSSNVLLGTEFEACLTDYCLAV
LADSSSTEDPDSAAYKAPEIRKSSRRLTPKTDVYAFGVFLLELLTGKHPSQHPVLVPHDM
LEWVRTMREDDGEEYNRLGMLTEVASVCSLTSLEQRPAMWQVLKMIQEIKESAMMEDSAS
FGSSNEFRYEINHGNFYVWSAQAQLRNLINFFVYDDPMSSITPEIVYMMLPKAFVSKFLQ
KLSFNSSIHSEMQRGSRTNQDLLGQQTHKLSS
Download sequence
Identical sequences Tc01_g005520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]